PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009631116.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 225aa    MW: 26291.8 Da    PI: 5.2639
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009631116.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.72.6e-203992356
                    --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                     R++f++eq++ Le +Fe +  p  +++++LAk+lgL+ rqV +WFqN+Ra+ k
  XP_009631116.1 39 MRRRFNDEQIRSLEHMFETEARPELRTKQQLAKSLGLQPRQVAIWFQNKRARSK 92
                    699*************************************************99 PP

2HD-ZIP_I/II105.73.7e-3440130393
     HD-ZIP_I/II   3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     +rr+++eq+++LE++Fe+e + e + K++la++Lglqprqva+WFqn+RAR k+kqlE++y++Lk +yd+l ++ e+L+ke+e+L  +l++
  XP_009631116.1  40 RRRFNDEQIRSLEHMFETEARPELRTKQQLAKSLGLQPRQVAIWFQNKRARSKSKQLEMEYRMLKISYDNLGSKYEMLKKENEALLIQLQR 130
                     79***********************************************************************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.58E-182496IPR009057Homeodomain-like
PROSITE profilePS5007117.5563494IPR001356Homeobox domain
SMARTSM003891.9E-173698IPR001356Homeobox domain
PfamPF000461.3E-173992IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-1839101IPR009057Homeodomain-like
CDDcd000861.75E-154095No hitNo description
PRINTSPR000316.3E-66574IPR000047Helix-turn-helix motif
PROSITE patternPS0002706992IPR017970Homeobox, conserved site
PRINTSPR000316.3E-67490IPR000047Helix-turn-helix motif
PfamPF021832.4E-1494133IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MSVGERPPTN SNMWSQSSLL GKDLNLHSMS SIKNCKDNMR RRFNDEQIRS LEHMFETEAR  60
PELRTKQQLA KSLGLQPRQV AIWFQNKRAR SKSKQLEMEY RMLKISYDNL GSKYEMLKKE  120
NEALLIQLQR LRKITEKVGN GEIQHEGNKL ETEVIKLEFI PETCSPEFGL PLCEDSREID  180
YLGTESDILN MAQIAYGLSE IENECNIESR TFFDDSDCRS PLWEF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009631116.11e-167PREDICTED: homeobox-leucine zipper protein ATHB-12-like
TrEMBLK4CPV91e-89K4CPV9_SOLLC; Uncharacterized protein
STRINGSolyc08g083130.2.13e-89(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA102732125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.11e-39homeobox 7